Thermococcus aggregans: NF865_01895 Help Entry NF865_01895       CDS       T10933                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tagg  Thermococcus aggregans Pathway tagg03010   Ribosome Brite Ribosome [BR:tagg03011]  Ribosomal proteins   Eukaryotes    Small subunit     NF865_01895   Archaea     NF865_01895 Ubiquitin system [BR:tagg04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NF865_01895 Exosome [BR:tagg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NF865_01895   Exosomal proteins of colorectal cancer cells    NF865_01895 BRITE hierarchy Other DBs NCBI-ProteinID:  USS40996 UniProt:  A0A9E7MXZ9 LinkDB All DBs Position complement(330568..330732) Genome browser AA seq 54 aa AA seqDB search MAKKPSQKWKLYEVKDGKVVRKNRFCPRCGPGVFMANHKDRWTCGRCGYTEWKK NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atggctaagaaaccctcacaaaaatggaagctttatgaagttaaggatggaaaagtcgtt aggaagaacaggttctgcccaagatgcggtcctggagtctttatggcaaaccacaaggac agatggacctgcggtaggtgcggctacacagagtggaagaagtga

DBGET integrated database retrieval system