Candidatus Nitrosotenuis cloacae: SU86_002255 Help Entry SU86_002255       CDS       T03883                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism tah  Candidatus Nitrosotenuis cloacae Pathway tah03060   Protein export tah03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:tah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SU86_002255  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SU86_002255  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tah02044]     SU86_002255 Secretion system [BR:tah02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SU86_002255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AJZ75399 UniProt:  A0A3G1B0Y7 LinkDB All DBs Position 930788..930982 Genome browser AA seq 64 aa AA seqDB search MLQTVAGFIAGQEWIFIAIAAGIIIFGAKKIPDLARTLGKSRGEYEKGKIEAEKELKDLK EKKD NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgctacaaaccgttgcagggttcatcgcagggcaggaatggatctttattgcaatagca gcaggcatcatcatatttggtgcaaaaaagattccagacctagcaagaacgctgggaaaa tcacgcggtgaatacgaaaagggcaaaatcgaggcagaaaaagagctcaaagacctcaaa gagaagaaagactag

DBGET integrated database retrieval system