KEGG   Thermanaerovibrio acidaminovorans: Taci_0989
Entry
Taci_0989         CDS       T01129                                 
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
tai  Thermanaerovibrio acidaminovorans
Brite
KEGG Orthology (KO) [BR:tai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tai03016]
    Taci_0989
Enzymes [BR:tai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Taci_0989
Transfer RNA biogenesis [BR:tai03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Taci_0989
 Prokaryotic type
    Taci_0989
SSDB
Motif
Pfam: TruB_N TruB_C_2 PseudoU_synth_2
Other DBs
NCBI-ProteinID: ACZ19221
UniProt: D1BAB8
LinkDB
Position
complement(1034336..1035241)
AA seq 301 aa
MRSGFLLIDKEEGLRSTACVEAVRRSLGRDFKVGHAGTLDSGASGLLVALVGRATRLSNL
VMSFSKEYRALVRLGIRTDTEDITGRILDRCPVPRWDAGDLSRVLASFLGCRLQRPPAVS
AVHVGGRRAHELARSGEEPNIVPREVFVRRIEVGEMLGPDVVSIRVSCGKGTYVRSIARD
LGERLGTWGTIERLRRTSVGPFRVEDALPSGQMGELGTRDLLSRLIPLERLGEFLPGGRV
PAELDALCSNGGAIRIRDLEAFSVRAPYVSGGLVLVRYSRGMGIYQLVGDGRLECRVNLP
D
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcggtccggcttccttctgatagataaggaggaggggctgaggagcaccgcctgcgtg
gaggcggtgaggaggtccctcggcagggatttcaaggttgggcacgcggggacgttggac
tccggcgccagcggcctgttggtggccctggtcggcagggccaccaggctgtccaacctg
gtgatgtcgttctcaaaggagtaccgggccctggtccggctgggcatccggaccgacacg
gaggacataacgggacggatattggaccgatgcccggtcccccgctgggatgcaggggat
ttaagcagggtcttggcctccttcctgggttgccgccttcagcgcccccccgccgtctcg
gcggtccacgtggggggcaggagggcccacgagctggcccgctcgggagaggagcccaac
atagtcccccgggaggtcttcgtccggcgcattgaagtgggggagatgttgggccctgat
gtggtctccattcgggtttcctgcggtaagggcacctacgtcaggtccatagccagggac
ctgggggagaggcttggaacctggggcacgatagagcggctccggcggacctcggtgggc
cccttcagggttgaggacgcgctcccgtccggccagatgggggagctcggcacccgggac
ctgttgagcaggctgatccccctggagaggctcggggagttcctgcccggtggccgggtc
cctgcggagctggacgccctctgcagcaacggaggggcgatccggatccgggacctggag
gccttctcggttcgggccccttacgtttccggcgggttggtgctggtcagatactcccgt
ggcatgggtatctaccagctggtgggggacgggcgcctggagtgtagggtcaacctgccc
gattga

DBGET integrated database retrieval system