KEGG   Terribacillus sp. DMT04: KS242_02565
Entry
KS242_02565       CDS       T07391                                 
Symbol
tenA
Name
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
taid  Terribacillus sp. DMT04
Pathway
taid00730  Thiamine metabolism
taid01100  Metabolic pathways
taid01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:taid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KS242_02565 (tenA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:taid03000]
    KS242_02565 (tenA)
Enzymes [BR:taid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     KS242_02565 (tenA)
Transcription factors [BR:taid03000]
 Prokaryotic type
  Other transcription factors
   Others
    KS242_02565 (tenA)
SSDB
Motif
Pfam: TENA_THI-4
Other DBs
NCBI-ProteinID: QXE02152
LinkDB
Position
466313..467011
AA seq 232 aa
MFSAQLREEANPVFEAIYQHPFVEGVANGQVPREALIHYVKADYEYLTAFARIYGLAVSK
CETREEMAFFQSQIHFVLHSEIHPHNVFCKVAGVDYEDLQKMTPPPAADHYISHMMNSAV
QGDMGELMAALLPCPWTYQALAEHIIETKAPDQNNPFLEWIMFYANNEDGMPDVTAELCK
RLDKWAETAGSAAKERARKAFLKSCMLEHSFWEMAITEQNWLVPLEKGAAHV
NT seq 699 nt   +upstreamnt  +downstreamnt
atgttttctgcacagttgagagaagaagcaaacccggttttcgaagcaatttatcagcat
ccttttgttgaaggggtggcgaatggacaggtgccgcgcgaagcattaatccattacgtg
aaggcggattatgagtacttgactgcatttgctcgaatttatggcttggcagtcagcaaa
tgtgagacaagagaagagatggcgttctttcaatcgcaaatccactttgttctgcacagt
gagattcatccgcataatgtcttttgtaaagtggcaggtgtggactatgaggacttgcag
aaaatgacaccccctcccgcagccgatcactatatttctcatatgatgaacagcgctgta
caaggagatatgggagaactgatggcggcgctgttaccttgtccatggacgtatcaggca
ctggcagagcatattatcgaaacaaaggcgccggaccagaataatccatttttagagtgg
attatgttttatgcaaacaatgaagatggaatgccggatgtgacagccgaactttgcaaa
agattggataaatgggctgaaacggccggttcggctgccaaggaacgcgcgcggaaagca
ttcttgaagagctgtatgctggaacatagtttttgggaaatggccattacagaacaaaac
tggctggtaccgctcgaaaaaggggccgcccatgtctaa

DBGET integrated database retrieval system