Tyto alba (Barn owl): 104355659 Help Entry 104355659         CDS       T07816                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism tala  Tyto alba (Barn owl) Pathway tala03082   ATP-dependent chromatin remodeling tala04217   Necroptosis Brite KEGG Orthology (KO) [BR:tala00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104355659  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104355659  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tala03036]     104355659   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tala04147]     104355659 Chromosome and associated proteins [BR:tala03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104355659 Exosome [BR:tala04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104355659 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104355659 NCBI-ProteinID:  XP_009973305 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtccggccgcgggaagcagggcgggaaggcgcgtgccaaggcgaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgcgtccaccggctgcttcggaaagggaactac gcggagcgggtgggcgccggcgcgccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccccggcacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtgaccatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctgcccaagaag acggagagccacaaagccaagagcaagtag

DBGET integrated database retrieval system