Tyto alba (Barn owl): 104359520 Help Entry 104359520         CDS       T07816                                  Symbol CETN2 Name (RefSeq) centrin-2 isoform X1   KO K10840   centrin-2 Organism tala  Tyto alba (Barn owl) Pathway tala03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tala00001]  09120 Genetic Information Processing   09124 Replication and repair    03420 Nucleotide excision repair     104359520 (CETN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tala03019]     104359520 (CETN2)    03036 Chromosome and associated proteins [BR:tala03036]     104359520 (CETN2)    03400 DNA repair and recombination proteins [BR:tala03400]     104359520 (CETN2) Messenger RNA biogenesis [BR:tala03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      104359520 (CETN2) Chromosome and associated proteins [BR:tala03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     104359520 (CETN2)    Centrosome duplication proteins     Centriole replication proteins      104359520 (CETN2) DNA repair and recombination proteins [BR:tala03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      XPC-HR23B-CETN2 complex       104359520 (CETN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_5 EH EF_EFCAB10_C EF-hand_14 Dockerin_1 HerA_C DUF7645 SurA_N_3 SRI SUB1_ProdP9 LETM1_RBD DUF5580_M CARF_Card1 MJ1010-like_2nd Motif Other DBs NCBI-GeneID:  104359520 NCBI-ProteinID:  XP_032855356 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MASSFKKPSLGAQRKKASPKLELTEEQKQEIQEAFDLFDTDGTGSIDVKELKVAMRALGF EPKKEEIKKMISDVDKEGTGKISFHDFLVVMTQKMAEKDSKEEILKAFKLFDDDETGKIS FKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggcctctagctttaagaagccctcgctaggagcccagaggaagaaagcgagccccaag ctggagctgactgaggagcagaagcaggagatccaggaggctttcgacctgtttgacaca gacggcaccgggagcatagatgtgaaggagctaaaggtggccatgagagcactggggttt gaacctaaaaaagaagagatcaagaaaatgatatcagatgttgataaggaaggaacagga aaaatcagcttccatgacttcttggtagtgatgacacaaaaaatggctgaaaaagattcc aaagaggagattctcaaagctttcaaactctttgatgacgatgaaactggcaaaatctct ttcaaaaacctcaaacgtgtcgccaaagaactgggggaaaatctcacagatgaagagctg caggaaatgatcgatgaagcagatagagatggggatggggaagtgaatgaacaagaattc ttgcggatcatgaagaagaccagcctttactga

DBGET integrated database retrieval system