Tyto alba (Barn owl): 104363498 Help Entry 104363498         CDS       T07816                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism tala  Tyto alba (Barn owl) Pathway tala04081   Hormone signaling tala04144   Endocytosis tala04150   mTOR signaling pathway tala04270   Vascular smooth muscle contraction tala04310   Wnt signaling pathway tala04350   TGF-beta signaling pathway tala04510   Focal adhesion tala04520   Adherens junction tala04530   Tight junction tala04621   NOD-like receptor signaling pathway tala04625   C-type lectin receptor signaling pathway tala04810   Regulation of actin cytoskeleton tala05100   Bacterial invasion of epithelial cells tala05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tala00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104363498 (RHOA)    04350 TGF-beta signaling pathway     104363498 (RHOA)    04150 mTOR signaling pathway     104363498 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104363498 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104363498 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104363498 (RHOA)    04520 Adherens junction     104363498 (RHOA)    04530 Tight junction     104363498 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104363498 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104363498 (RHOA)    04625 C-type lectin receptor signaling pathway     104363498 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104363498 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104363498 (RHOA)    05100 Bacterial invasion of epithelial cells     104363498 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tala04131]     104363498 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tala04147]     104363498 (RHOA)    04031 GTP-binding proteins [BR:tala04031]     104363498 (RHOA) Membrane trafficking [BR:tala04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104363498 (RHOA) Exosome [BR:tala04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104363498 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104363498 (RHOA)   Exosomal proteins of colorectal cancer cells    104363498 (RHOA)   Exosomal proteins of bladder cancer cells    104363498 (RHOA) GTP-binding proteins [BR:tala04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104363498 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104363498 NCBI-ProteinID:  XP_042655300 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccactgtctttgaa aattatgtagcagatatcgaagtggacggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactatgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgatgagcacacaagacgagaactggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system