Tyto alba (Barn owl): 104365067 Help Entry 104365067         CDS       T07816                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism tala  Tyto alba (Barn owl) Pathway tala04010   MAPK signaling pathway tala04012   ErbB signaling pathway tala04068   FoxO signaling pathway tala04137   Mitophagy - animal tala04140   Autophagy - animal tala04144   Endocytosis tala04150   mTOR signaling pathway tala04210   Apoptosis tala04218   Cellular senescence tala04370   VEGF signaling pathway tala04371   Apelin signaling pathway tala04510   Focal adhesion tala04519   Cadherin signaling tala04540   Gap junction tala04625   C-type lectin receptor signaling pathway tala04810   Regulation of actin cytoskeleton tala04910   Insulin signaling pathway tala04912   GnRH signaling pathway tala04916   Melanogenesis tala05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tala00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104365067 (HRAS)    04012 ErbB signaling pathway     104365067 (HRAS)    04370 VEGF signaling pathway     104365067 (HRAS)    04371 Apelin signaling pathway     104365067 (HRAS)    04068 FoxO signaling pathway     104365067 (HRAS)    04150 mTOR signaling pathway     104365067 (HRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     104365067 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104365067 (HRAS)    04140 Autophagy - animal     104365067 (HRAS)    04137 Mitophagy - animal     104365067 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104365067 (HRAS)    04218 Cellular senescence     104365067 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104365067 (HRAS)    04540 Gap junction     104365067 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104365067 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104365067 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104365067 (HRAS)    04912 GnRH signaling pathway     104365067 (HRAS)    04916 Melanogenesis     104365067 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104365067 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tala04131]     104365067 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tala04147]     104365067 (HRAS)    04031 GTP-binding proteins [BR:tala04031]     104365067 (HRAS) Membrane trafficking [BR:tala04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104365067 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104365067 (HRAS) Exosome [BR:tala04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104365067 (HRAS)   Exosomal proteins of colorectal cancer cells    104365067 (HRAS) GTP-binding proteins [BR:tala04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104365067 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N Motif Other DBs NCBI-GeneID:  104365067 NCBI-ProteinID:  XP_032859288 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgtcgggaagagcgctttgacg atacagctcattcagaatcattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcattgatggggagacctgcttgttagacatcttggataccgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctgtgt gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactccgatgatgttcccatggtgctggtgggaaataagtgtgacctg ccagcccggaccgtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaacccccccgacgagagcggccccggc tgcatgaactgtaaatgcgtgatatcgtga

DBGET integrated database retrieval system