Tyto alba (Barn owl): 104368806 Help Entry 104368806         CDS       T07816                                  Symbol INS Name (RefSeq) LOW QUALITY PROTEIN: insulin   KO K04526   insulin Organism tala  Tyto alba (Barn owl) Pathway tala04010   MAPK signaling pathway tala04068   FoxO signaling pathway tala04081   Hormone signaling tala04114   Oocyte meiosis tala04140   Autophagy - animal tala04150   mTOR signaling pathway tala04810   Regulation of actin cytoskeleton tala04910   Insulin signaling pathway tala04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tala00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104368806 (INS)    04068 FoxO signaling pathway     104368806 (INS)    04150 mTOR signaling pathway     104368806 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104368806 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104368806 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104368806 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104368806 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104368806 (INS)    04914 Progesterone-mediated oocyte maturation     104368806 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tala04052]     104368806 (INS) Cytokines and neuropeptides [BR:tala04052]  Neuropeptides   Unclassified    104368806 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  104368806 NCBI-ProteinID:  XP_009974501 UniProt:  A0A093EJH4 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MGILLPTNXSSSDREDFSPSPAATSLGLTLPTMALWIRSLPLLALLALSDPGTSHAAANQ HLCGSHLVEALYLVCGERGFFYSPKARRDVEQPLVSGPLHGEVGELPFHQEEFEKVKRGI VEQCCHNTCSLYQLENYCN NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggggatattgctaccaaccaactagtcttcatctgacagagaagacttctctccatct cctgctgccacttctttgggcctcaccctgcccaccatggctctctggatccgatcgctg cctctcctggcccttctcgctctgtccgaccccgggaccagccacgcggctgccaaccag cacctctgcggctcccatttggtggaggctctctacctggtgtgtggagagaggggtttc ttctactcccccaaagcccgacgggacgttgagcagcctctagtgagcggtcccctgcat ggtgaggtaggagagctgcccttccatcaggaggagtttgagaaagtgaagcgagggatc gttgagcaatgctgccacaacacgtgctccctctaccaactggaaaactactgcaactag

DBGET integrated database retrieval system