Tyto alba (Barn owl): 116961046 Help Entry 116961046         CDS       T07816                                  Symbol B2M Name (RefSeq) beta-2-microglobulin   KO K08055   beta-2-microglobulin Organism tala  Tyto alba (Barn owl) Pathway tala05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:tala00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     116961046 (B2M)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tala04147]     116961046 (B2M) Exosome [BR:tala04147]  Exosomal proteins   Exosomal proteins of breast milk    116961046 (B2M) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set Ig_3 Ig_2 I-set ig C2-set_2 Motif Other DBs NCBI-GeneID:  116961046 NCBI-ProteinID:  XP_042660013 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MGLAAMGLAVRAGVLVLIALAGLGEPFEPPKVEVYSRSHASDGQQNTLNCFVSGFHPPKI EITLLKNGEPMSGVKYADMTFDDKWAFQRLVYAPFTPQKGDVYVCRVAHSAFREPQSFRW DSDF NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggggctagcagccatggggctagcggtgcgggcgggcgtcctggtgctaatcgcgctg gccggcctgggggagccgtttgaaccgccgaaagtggaggtgtactcccgcagccatgcc tcagacggacagcagaacaccctcaactgcttcgtgagtggtttccaccctccgaagatc gagatcaccctcctgaagaacggggagcccatgagcggcgtcaagtacgcggacatgacc ttcgatgacaagtgggctttccagcgcctggtgtacgcgcccttcaccccccagaagggc gacgtctacgtttgcagggtggcccattctgccttccgcgagccgcagtctttccgatgg gattcagacttctga

DBGET integrated database retrieval system