Thermobifida alba: FOF52_09620 Help Entry FOF52_09620       CDS       T08159                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism talx  Thermobifida alba Pathway talx01100   Metabolic pathways talx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:talx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FOF52_09620    00074 Mycolic acid biosynthesis     FOF52_09620   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FOF52_09620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF5031 Motif Other DBs NCBI-ProteinID:  UPT21183 LinkDB All DBs Position 2194306..2194545 Genome browser AA seq 79 aa AA seqDB search MAHSEKEILDGLAEIIDEIAGVPAAEVTPEKSFVDDLDIDSLSMVEIAVAAQDKFGVEIP DDQLKDLKTVQDVITYIQK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggctcactcggagaaggagatcctggacggtctcgccgagatcatcgacgagatcgcc ggtgtccccgcggccgaggtcaccccggagaagagcttcgtggacgacctcgacatcgac tcgctgtcgatggtcgagatcgccgtcgccgcgcaggacaagttcggcgtggagatcccc gacgaccagctcaaggacctcaagacggtccaggacgtcatcacctacatccagaagtag

DBGET integrated database retrieval system