Temnothorax americanus: 143899289 Help Entry 143899289         CDS       T11456                                  Symbol E(y)2 Name (RefSeq) enhancer of yellow 2 isoform X1   KO K11368   enhancer of yellow 2 transcription factor Organism tame  Temnothorax americanus Brite KEGG Orthology (KO) [BR:tame00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tame03021]     143899289 (E(y)2)    03019 Messenger RNA biogenesis [BR:tame03019]     143899289 (E(y)2)    03036 Chromosome and associated proteins [BR:tame03036]     143899289 (E(y)2) Transcription machinery [BR:tame03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      143899289 (E(y)2) Messenger RNA biogenesis [BR:tame03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      143899289 (E(y)2) Chromosome and associated proteins [BR:tame03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      143899289 (E(y)2)     SLIK complex      143899289 (E(y)2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 Retrotran_gag_4 NLE Motif Other DBs NCBI-GeneID:  143899289 NCBI-ProteinID:  XP_077265620 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MKTPHQRLVMVGDRDGLKELLRRRLVECGWRDQVKLISKEIVKEHGHDVTYDTLLSAVTS KARTLVPDSVKKELLQKIKNQLLAQEEKLKIVTDR NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagacgccgcaccagagattggttatggttggcgatcgcgacgggctgaaggaactg ttgaggcgcagactggtggagtgcggatggcgggaccaggtgaagctgatatcgaaggag atagtaaaggagcacggtcacgatgtcacctacgacacgctgctatccgcggtgaccagc aaagctcgcacgctcgtgccggactcggtgaagaaggagctgctgcagaagatcaagaat cagctgttggctcaggaggagaagctgaaaattgtgacagaccgttag

DBGET integrated database retrieval system