Temnothorax americanus: 143907881 Help Entry 143907881         CDS       T11456                                  Symbol Sec61beta Name (RefSeq) sec61 translocon subunit beta   KO K09481   protein transport protein SEC61 subunit beta Organism tame  Temnothorax americanus Pathway tame03060   Protein export tame04141   Protein processing in endoplasmic reticulum tame04145   Phagosome Brite KEGG Orthology (KO) [BR:tame00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     143907881 (Sec61beta)    04141 Protein processing in endoplasmic reticulum     143907881 (Sec61beta)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     143907881 (Sec61beta)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tame04131]     143907881 (Sec61beta)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:tame02044]     143907881 (Sec61beta) Membrane trafficking [BR:tame04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     143907881 (Sec61beta) Secretion system [BR:tame02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    143907881 (Sec61beta) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  143907881 NCBI-ProteinID:  XP_077281064 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MPAAPSATSVGSVGRSPSKAIAPRTGGGGTVRQRKTTVATSARNRTTGTSSGGMWRFYTD DSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRN NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcccgccgcgccgagcgctacctccgtgggatccgtcggacggtcgcccagcaaggcc atagcgcctagaacaggtggtggtggcacagtcagacagaggaaaactaccgtcgccacc tccgccaggaacaggaccaccggcacgagctccggtggcatgtggaggttttacaccgac gactctcctggcattaaagtgggaccagtgccagtgctagtcatgtccctcttgttcatt gcatccgtatttatgcttcatatctggggcaagtacactagaaactag

DBGET integrated database retrieval system