Tahibacter amnicola: N4264_03735 Help Entry N4264_03735       CDS       T09840                                  Name (GenBank) ACT domain-containing protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism tamn  Tahibacter amnicola Pathway tamn00290   Valine, leucine and isoleucine biosynthesis tamn00650   Butanoate metabolism tamn00660   C5-Branched dibasic acid metabolism tamn00770   Pantothenate and CoA biosynthesis tamn01100   Metabolic pathways tamn01110   Biosynthesis of secondary metabolites tamn01210   2-Oxocarboxylic acid metabolism tamn01230   Biosynthesis of amino acids Module tamn_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine tamn_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:tamn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     N4264_03735    00660 C5-Branched dibasic acid metabolism     N4264_03735   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     N4264_03735   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     N4264_03735 Enzymes [BR:tamn01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      N4264_03735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  UXI68775 LinkDB All DBs Position 892269..892502 Genome browser AA seq 77 aa AA seqDB search MSCSLELALDRAEGALLRVLGTIERRGWNLVTVSAASGPNVYAVKVTLDGARDPEILCRQ LERLVDVQNVRLLAAEV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagttgcagcctggagctcgcgctggatcgggccgaaggcgcgctgctgcgcgtgctg ggcacgatcgagcggcgtggctggaatctggtgacggtgagtgcggccagcgggccgaat gtttatgcagtcaaggtaacgctcgacggcgcgcgcgatccggagatcctctgccggcaa ctggaacggctggtggatgtccagaatgtgcgtctgctggcggcggaagtctga

DBGET integrated database retrieval system