Tahibacter amnicola: N4264_07515
Help
Entry
N4264_07515 CDS
T09840
Name
(GenBank) diguanylate cyclase
KO
K11444
two-component system, chemotaxis family, response regulator WspR [EC:
2.7.7.65
]
Organism
tamn
Tahibacter amnicola
Pathway
tamn02020
Two-component system
Brite
KEGG Orthology (KO) [BR:
tamn00001
]
09130 Environmental Information Processing
09132 Signal transduction
02020 Two-component system
N4264_07515
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02022 Two-component system [BR:
tamn02022
]
N4264_07515
Enzymes [BR:
tamn01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.65 diguanylate cyclase
N4264_07515
Two-component system [BR:
tamn02022
]
CheA family
WspE-WspRF (chemosensory)
N4264_07515
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GGDEF
Response_reg
PBECR5
Motif
Other DBs
NCBI-ProteinID:
UXI69489
UniProt:
A0ABY6BI76
LinkDB
All DBs
Position
complement(1806115..1807281)
Genome browser
AA seq
388 aa
AA seq
DB search
MSQKIERAKVLVIDDQVVILEALRRLLSADDLEIHLHNDSASAVAKARAIAPAVILLDIH
MNPINGLDVLRGIRAQPELADVPVVMLSAVEDPETKVEAFKYGANDYVVKLPSPLELNAR
VRYHANALKAARERAEAYEALLRSQSELEQRNRLIEQINRELAESVLTDTLTGLRNRRFL
KLFLDEHTESRRASHERRRAPARTTVFLMDLDHFKQINDRLGHDAGDIALVETAARLRSS
VRADDAVLRWGGEEFLIIARYYDLDEPTAAAQRLLEAIGGSPMQLGPHQETVTCSVGYAP
FPWVGEKLAQASIEQTLSLADAACYLSKTAGRNRAFGVLPGPDDARAARISGLGISPATL
RSEDGRGVRLVESVGPAIGRLDLASTSG
NT seq
1167 nt
NT seq
+upstream
nt +downstream
nt
atgagccagaaaatcgagcgtgccaaggtcctggtcatcgacgatcaggtcgtcattctc
gaagccttacggcgcctgctgtccgccgacgacctggaaattcacctgcacaacgactcc
gcgagcgccgtagcgaaggctcgcgcgatcgcaccggcggtcattctcctcgatattcac
atgaacccgatcaacggcctggacgtgctgcgcggcatccgcgcgcagcccgagctggcc
gacgtgcccgtggtgatgctgtccgcggtggaagatccggaaaccaaggtcgaagcgttc
aagtacggcgccaacgactacgtcgtgaaactgcccagccccctggaactcaacgcccgc
gtccgctaccacgccaacgcgctcaaggccgcgcgcgagcgcgcggaagcctacgaggcg
ctgctgcgcagccagtccgagctggagcaacgcaaccggttgatcgagcagatcaaccgc
gagctggccgagtcggtgctgaccgacaccttgaccggtttgcgcaatcgccgctttctg
aaattgttccttgacgagcataccgagtcccgccgggccagccacgaacgccgccgcgcg
ccggcgcgcacgacggtattcctgatggatctggaccacttcaagcagatcaacgaccgg
ctcggccatgacgccggtgacatcgccctggtcgagaccgcggcccggttgcgctcgtca
gtacgggcggacgatgccgtgttgcgctggggcggcgaagagttcctgatcattgcgcgc
tactacgacctggatgagccgacggccgctgcacaacgcctgctggaggcgatcggcggc
tcacccatgcagctgggcccgcaccaggagacggtgacctgctcggtcggctatgcaccc
tttccgtgggtgggcgaaaagctggcgcaggcatccatcgagcagacactcagcctggcg
gatgccgcctgctacctgagcaagacagccggccgcaaccgtgcctttggcgtgctgccc
ggacctgacgacgcgcgtgccgcgcgaatctccggactcggcatttcgccggcgacgctg
cgcagcgaagacggacgcggcgtgcgcctggtggaaagcgttggacctgcgattggcagg
ctggacctcgcctcgacgtccgggtag
DBGET
integrated database retrieval system