Theileria annulata: TA04975 Help Entry TA04975           CDS       T00253                                  Name (RefSeq) hypothetical protein, conserved   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism tan  Theileria annulata Pathway tan03022   Basal transcription factors tan03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tan00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     TA04975   09124 Replication and repair    03420 Nucleotide excision repair     TA04975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:tan03021]     TA04975    03400 DNA repair and recombination proteins [BR:tan03400]     TA04975 Transcription machinery [BR:tan03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      TA04975 DNA repair and recombination proteins [BR:tan03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      TA04975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  3864697 NCBI-ProteinID:  XP_954820 UniProt:  Q4UCV7 LinkDB All DBs Position 3:238991..239264 Genome browser AA seq 71 aa AA seqDB search MVSALTGTLLKCDPPTMEIVKQINESKHFIIEQIDEGVALCKDSVTQFLKEEVTRRLEIA ECYIPPNEQQK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggtttcagctttgacaggaactctattaaaatgtgatcctcctacaatggaaatagtt aaacaaataaatgaaagtaaacactttattattgagcaaattgatgagggagtagcactt tgtaaagactccgtaacacaatttctcaaggaagaagttactagaagacttgaaatcgca gaatgttatattccaccaaatgaacaacaaaaataa

DBGET integrated database retrieval system