Theileria annulata: TA19540 Help Entry TA19540           CDS       T00253                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism tan  Theileria annulata Pathway tan04517   IgSF CAM signaling tan04814   Motor proteins Brite KEGG Orthology (KO) [BR:tan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     TA19540  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     TA19540  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tan03037]     TA19540    04812 Cytoskeleton proteins [BR:tan04812]     TA19540 Cilium and associated proteins [BR:tan03037]  Motile cilia and associated proteins   Dynein arm    TA19540 Cytoskeleton proteins [BR:tan04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      TA19540 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DNA_pol3_a_NI Motif Other DBs NCBI-GeneID:  3864039 NCBI-ProteinID:  XP_954491 UniProt:  Q4UGH5 LinkDB All DBs Position 1:<2130790..>2131086 Genome browser AA seq 98 aa AA seqDB search MATLRNDAKPTIEDAVIKNVDMDETTKAFALKVAFDAITKFEVEKDIAGHIKKEFDKTYE PTWHCIVGKNFGSFVTHEKHCFIYFYLGKMAFLIFKNG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcaacacttagaaacgacgcaaaacccactatagaagacgctgtcatcaagaacgtc gacatggacgaaaccaccaaggcctttgcactcaaagtcgcctttgatgcaatcaccaag ttcgaggttgagaaggacattgcaggacacatcaagaaggagttcgacaagacctacgag ccaacatggcactgcattgtcggaaagaacttcggttccttcgtcactcacgagaagcac tgcttcatttacttttacctaggcaaaatggcctttcttatcttcaaaaacggttaa

DBGET integrated database retrieval system