Theileria annulata: TA19540 Help Entry TA19540           CDS       T00253                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism tan  Theileria annulata Pathway tan04145   Phagocytosis tan04517   IgSF CAM signaling tan04814   Motor proteins Brite KEGG Orthology (KO) [BR:tan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     TA19540  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     TA19540   09142 Cell motility    04814 Motor proteins     TA19540  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tan03037]     TA19540    04812 Cytoskeleton proteins [BR:tan04812]     TA19540 Cilium and associated proteins [BR:tan03037]  Motile cilia and associated proteins   Dynein arm    TA19540 Cytoskeleton proteins [BR:tan04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      TA19540 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DNA_pol3_a_NI Motif Other DBs NCBI-GeneID:  3864039 NCBI-ProteinID:  XP_954491 UniProt:  Q4UGH5 LinkDB All DBs Position 1:<2130790..>2131086 Genome browser AA seq 98 aa AA seqDB search MATLRNDAKPTIEDAVIKNVDMDETTKAFALKVAFDAITKFEVEKDIAGHIKKEFDKTYE PTWHCIVGKNFGSFVTHEKHCFIYFYLGKMAFLIFKNG NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcaacacttagaaacgacgcaaaacccactatagaagacgctgtcatcaagaacgtc gacatggacgaaaccaccaaggcctttgcactcaaagtcgcctttgatgcaatcaccaag ttcgaggttgagaaggacattgcaggacacatcaagaaggagttcgacaagacctacgag ccaacatggcactgcattgtcggaaagaacttcggttccttcgtcactcacgagaagcac tgcttcatttacttttacctaggcaaaatggcctttcttatcttcaaaaacggttaa

DBGET integrated database retrieval system