KEGG   Typha angustifolia (narrow-leaf cattail): 140761410
Entry
140761410         CDS       T11061                                 
Name
(RefSeq) SKP1-like protein 11
  KO
K03094  S-phase kinase-associated protein 1
Organism
tang  Typha angustifolia (narrow-leaf cattail)
Pathway
tang03083  Polycomb repressive complex
tang04120  Ubiquitin mediated proteolysis
tang04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    140761410
   04120 Ubiquitin mediated proteolysis
    140761410
  09126 Chromosome
   03083 Polycomb repressive complex
    140761410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tang04131]
    140761410
   04121 Ubiquitin system [BR:tang04121]
    140761410
   03036 Chromosome and associated proteins [BR:tang03036]
    140761410
Membrane trafficking [BR:tang04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    140761410
Ubiquitin system [BR:tang04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     140761410
   Cul7 complex
     140761410
Chromosome and associated proteins [BR:tang03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     140761410
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     140761410
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 140761410
NCBI-ProteinID: XP_072954822
LinkDB
Position
6:join(4832812..4833213,4834019..4834189)
AA seq 190 aa
MSMETAGGAVLPEDLQLRAAAAAELLAEVAFNEGLISPEKRRRSNKTVVLKNSDGSVLEV
DVTVAMESALIKRCLLSGKFENGVIGISGFRTKIFDMAIGFCRKTVVMKPSSSWEDMFVK
DVRIDSDALLDLISAANYLGIEGLKDMTCRKVAKMMKGKTTDDIRHLFYILDDLSISEKK
VIEKAKMADK
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtcgatggagacagcaggcggagcggtacttcccgaagacctccagctccgggcggcg
gcggcggcggagctgctggctgaggtggcgttcaatgagggcttgatctcgccagagaag
agacgcagatccaacaagacggtggtcctgaagaactcggatggctccgtactcgaagtg
gatgtaacagtagcgatggagtcggcgttgatcaagaggtgcctcctctccgggaagttt
gaaaatggcgtcataggcatcagcggcttcaggaccaaaatcttcgacatggccatcggg
ttctgcaggaagaccgtcgtaatgaaaccttccagttcctgggaggatatgttcgtgaag
gatgtccgtatcgattccgatgccctcctcgacctcatctcggctgcaaactaccttggg
atagagggactcaaggacatgacctgtcgaaaagtggccaagatgatgaagggaaagact
actgatgatattcgacatctgttttacatcctggatgatttgagtatttctgaaaagaaa
gtgatagaaaaagctaagatggctgacaaatga

DBGET integrated database retrieval system