Typha angustifolia (narrow-leaf cattail): 140770478
Help
Entry
140770478 CDS
T11061
Name
(RefSeq) SKP1-like protein 1B
KO
K03094
S-phase kinase-associated protein 1
Organism
tang Typha angustifolia (narrow-leaf cattail)
Pathway
tang03083
Polycomb repressive complex
tang04120
Ubiquitin mediated proteolysis
tang04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
tang00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
140770478
04120 Ubiquitin mediated proteolysis
140770478
09126 Chromosome
03083 Polycomb repressive complex
140770478
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
tang04131
]
140770478
04121 Ubiquitin system [BR:
tang04121
]
140770478
03036 Chromosome and associated proteins [BR:
tang03036
]
140770478
Membrane trafficking [BR:
tang04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
140770478
Ubiquitin system [BR:
tang04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
140770478
Cul7 complex
140770478
Chromosome and associated proteins [BR:
tang03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
140770478
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
140770478
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
RuBisCO_large_N
DUF1378
Motif
Other DBs
NCBI-GeneID:
140770478
NCBI-ProteinID:
XP_072967792
LinkDB
All DBs
Position
2:complement(join(7385539..7385712,7389123..7389431))
Genome browser
AA seq
160 aa
AA seq
DB search
MAKKITLKSSDGEVFEVEELVAMESQTIKHMIEDDCVENSIPLPNVTSKILSKVIEYCKK
HVDAAAASKASADESSKAADEELKQWDSEFVKVDQATLFDLILAANYLNIKGLLDLTCQT
VADMIKGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE
NT seq
483 nt
NT seq
+upstream
nt +downstream
nt
atggcgaagaagataaccctgaagagctcggacggcgaggtgttcgaggtggaggaattg
gttgccatggagtcgcaaacgatcaagcacatgatcgaggacgactgcgtcgagaacagc
atcccgctcccaaacgtcacctccaagatcctctccaaggtcatcgagtactgcaagaag
cacgtcgacgctgctgccgcatccaaggcgtcggcggacgagtcgtcgaaggcggctgat
gaggagctcaagcagtgggactccgagttcgtcaaggttgaccaggccaccctcttcgac
ctcatcttggctgcaaactatctgaacatcaaaggactactggatttgacttgccaaact
gttgcagacatgattaaggggaagacaccagaagagattcgcaagactttcaacattaag
aatgacttttctccggaagaagaggaagaggtgcgaagggagaaccagtgggcttttgag
tga
DBGET
integrated database retrieval system