Terribacillus saccharophilus: GZ22_00505 Help Entry GZ22_00505        CDS       T03216                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tap  Terribacillus saccharophilus Brite KEGG Orthology (KO) [BR:tap00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tap03032]     GZ22_00505    03036 Chromosome and associated proteins [BR:tap03036]     GZ22_00505    03400 DNA repair and recombination proteins [BR:tap03400]     GZ22_00505 DNA replication proteins [BR:tap03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GZ22_00505 Chromosome and associated proteins [BR:tap03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GZ22_00505 DNA repair and recombination proteins [BR:tap03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GZ22_00505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AIF65278 UniProt:  A0A075LLI0 LinkDB All DBs Position 92695..92967 Genome browser AA seq 90 aa AA seqDB search MNKAELVEAVAQQAELSKKDASKAVDALLETISETLAKEEKVQLVGFGTFEVRERAARTG RNPQTGEEITIPASKAPAFKAGKDFKEAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagcagaactagtagaagcagtagcacaacaagcagaactatctaaaaaagat gcaagcaaagcagttgatgcactacttgaaacaatctctgaaacacttgctaaagaagaa aaagtacagcttgtaggcttcggtacttttgaagtaagagagcgtgcagcacgtactggc cgtaacccacagacgggcgaagaaatcacaatccctgcttccaaagcgccagctttcaaa gcgggtaaagatttcaaagaagctgtaaaataa

DBGET integrated database retrieval system