KEGG   Thermus aquaticus: TO73_0750
Entry
TO73_0750         CDS       T04117                                 
Name
(GenBank) biotin carboxylase of acetyl-CoA carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
taq  Thermus aquaticus
Pathway
taq00061  Fatty acid biosynthesis
taq00620  Pyruvate metabolism
taq00640  Propanoate metabolism
taq00720  Other carbon fixation pathways
taq01100  Metabolic pathways
taq01110  Biosynthesis of secondary metabolites
taq01120  Microbial metabolism in diverse environments
taq01200  Carbon metabolism
taq01212  Fatty acid metabolism
Module
taq_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:taq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TO73_0750
   00640 Propanoate metabolism
    TO73_0750
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    TO73_0750
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    TO73_0750
Enzymes [BR:taq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     TO73_0750
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     TO73_0750
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A ATP-grasp_5 RimK ATPgrasp_ST ATPgrasp_YheCD ATPgrasp_Ter DUF3182
Other DBs
NCBI-ProteinID: ALJ90604
UniProt: A0ABN4IGA5
LinkDB
Position
655368..656705
AA seq 445 aa
MKKVLIANRGEIALRIIRAARELGIKTVVAHSTADEKSLPVLLADEAICIGPPPSGQSYL
NIPNLLSAAIVTGADAIHPGYGFLAENATFAEMCREHGITFIGPTPENMRALGDKATARK
VAREAGVPTVPGTDEVESVEEAKRAALEIGYPVILKASAGGGGRGMRVVHTEEDLERAVL
QAQEEARAAFGNPAVYLEKYIEEPKHIEIQVLGDGERVVHLWERDCSIQRRHQKLLEEAP
SILPLETRRAIAEAARRLAEHVGYVSAGTLEFLVDKEGNFYFIEMNTRIQVEHPVTEMVT
GVDLVQAQFRIAMGERLWLKQEEIEVRGHAIEVRVNAEDPEKGFRPSIGKVETLLFPGGP
GIRVDSHLYAGYQIPPHYDSLIAKIIAWAPSREEAIRRMERALGETVIEGPGLKTTIPFH
QKVLQNAFFRRGAVYTNFVARRMEL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaagaaggtcctgatcgccaaccggggggagatcgccttaaggatcatccgggcggcc
agggagctgggcatcaagaccgtggtggcccactccaccgccgacgagaagagcctccct
gtgctcctggccgacgaggccatctgcatcgggcctcccccttccgggcagagctacctc
aacatccccaacctcctctccgccgccatcgtcaccggggccgacgccatccatcccggt
tacggcttcctggccgagaacgccaccttcgccgagatgtgccgtgagcacgggatcacc
ttcatcggccccacgccggagaacatgcgggccctgggggacaaggccacggcccgcaag
gtggcccgggaggcgggggtgcccacggtcccgggcacggacgaggtggagagcgtggag
gaggccaagcgggccgccttggagatcggctatcccgtcatcctcaaggcctcggccggg
ggcggggggcgggggatgcgggtggtccacaccgaggaggacctggaaagggccgtcctg
caggcccaggaggaggcccgggccgccttcggcaaccccgccgtctacctggagaagtac
attgaggagcccaagcacatagagatccaggttctgggggacggggagcgggtggtccac
ctctgggagcgggactgctccatccagcgccgccaccagaagcttttagaggaggccccc
agcatcctgcccctggagacccggcgggccatcgccgaggcggccaggaggcttgcggag
cacgtgggctacgtctccgccgggaccctggagtttttggtggacaaggagggcaacttc
tacttcattgagatgaacacccgcatccaggtggagcaccccgtcacggagatggtgacg
ggggtggacctggtccaggcccagtttaggatcgccatgggggagaggctctggctcaag
caggaggagattgaggtccggggccacgccatagaggtgcgcgtcaacgccgaggacccg
gagaagggcttcaggccttccatcggcaaggtggagaccctgctctttcccggggggccc
ggcatcagggtggacagccacctctacgccggctaccagatcccccctcactacgacagc
ctgatcgccaagatcatcgcctgggcccccagccgggaggaggccataaggcgcatggag
cgggccctgggggagacggtcattgagggtcccgggctcaagaccaccatccccttccac
cagaaggtcctccagaacgccttcttccgccggggggccgtctacaccaacttcgtggcc
cggcggatggagttgtag

DBGET integrated database retrieval system