Thermus aquaticus: TO73_1550 Help Entry TO73_1550         CDS       T04117                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism taq  Thermus aquaticus Pathway taq01100   Metabolic pathways taq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:taq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TO73_1550    00074 Mycolic acid biosynthesis     TO73_1550   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TO73_1550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF2653 Motif Other DBs NCBI-ProteinID:  ALJ91391 LinkDB All DBs Position 1400325..1400567 Genome browser AA seq 80 aa AA seqDB search MSEQEIFEKVKAVIADKLQVEPEKVTLEARFVEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVAYIKAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcaggagatctttgaaaaggtgaaggcggttatcgcggacaaactccaggtg gagccggagaaggtgaccctcgaggcccgcttcgttgaggacctgggagccgacagcctg gacaccgtggagctcatcatgggcctggaggacgagttcggcctggagatctccgacgag gaggcggagaagatccgcaccgtcaaggacgcggtggcctacatcaaggccaagctgggc taa

DBGET integrated database retrieval system