Thermoplasmatales archaeon BRNA1: TALC_00526 Help Entry TALC_00526        CDS       T02532                                  Name (GenBank) LSU ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tar  Thermoplasmatales archaeon BRNA1 Pathway tar03010   Ribosome Brite KEGG Orthology (KO) [BR:tar00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TALC_00526   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TALC_00526  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tar03011]     TALC_00526    04121 Ubiquitin system [BR:tar04121]     TALC_00526 Ribosome [BR:tar03011]  Ribosomal proteins   Eukaryotes    Large subunit     TALC_00526   Archaea     TALC_00526 Ubiquitin system [BR:tar04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TALC_00526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e DZR Zn_Ribbon_1 Toxin_5 QueC Zn_ribbon_RanBP Motif Other DBs NCBI-ProteinID:  AGI47526 UniProt:  M4YU79 LinkDB All DBs Position 465324..465473 Genome browser AA seq 49 aa AA seqDB search MARFKEAERRLLDKSVCMSCYATNPPKATKCRKCGDSHLRPKAKESRKQ NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcacgcttcaaagaggctgagcgcaggctccttgacaagtccgtctgcatgagttgc tatgcgacgaacccccccaaggcaaccaagtgccgcaagtgcggcgacagtcacctcagg cccaaggcgaaagagagcaggaagcagtga

DBGET integrated database retrieval system