Tardiphaga sp. 709: RSO67_20440 Help Entry RSO67_20440       CDS       T10683                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism tard  Tardiphaga sp. 709 Pathway tard00190   Oxidative phosphorylation tard01100   Metabolic pathways Module tard_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:tard00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RSO67_20440  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:tard00194]     RSO67_20440 Photosynthesis proteins [BR:tard00194]  Photosystem and electron transport system   F-type ATPase [OT]    RSO67_20440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5714 Motif Other DBs NCBI-ProteinID:  WNV07870 UniProt:  A0AA96PAU2 LinkDB All DBs Position complement(4191153..4191380) Genome browser AA seq 75 aa AA seqDB search MDPIAAKYIGAGIACLGMGGAGIGVGMIFSQFLNGALRNPSASQGQFANLIFGFAVTEAL GIFSLLIALLLLFAV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatcccatcgcagcgaagtacatcggcgccggcattgcttgtctcggcatgggtggc gctggcatcggcgtcggcatgatcttcagccagttcctcaacggtgcgctccgcaatccg tcggcttcccagggccagttcgctaacctgatcttcggcttcgccgtgaccgaagcgctc ggcatcttctcgctgctgatcgctctgctgctgctgttcgccgtctaa

DBGET integrated database retrieval system