KEGG   Tardiphaga sp. vice154: FIU28_23190
Entry
FIU28_23190       CDS       T11090                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
tarv  Tardiphaga sp. vice154
Pathway
tarv00190  Oxidative phosphorylation
tarv01100  Metabolic pathways
tarv02020  Two-component system
tarv04148  Efferocytosis
Module
tarv_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:tarv00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FIU28_23190 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FIU28_23190 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    FIU28_23190 (petA)
Enzymes [BR:tarv01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     FIU28_23190 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: QDM23733
LinkDB
Position
complement(4931057..4931584)
AA seq 175 aa
MTTTSSAEHTRRDFLFVATGAVAAVGAAAVVWPLISQMNPDASTIAAGAPIDVDLAPIAE
GQDIKVFWRGKPIYIMHRTKKQIDEARAVTIASLPDPQTDQARVKEGHDQWLVVIGICTH
LGCIPIAHEGKYDGFFCPCHGSQYDSSGRIRSGPAPLNLPVPPYAFASDSKIKIG
NT seq 528 nt   +upstreamnt  +downstreamnt
gtgacgacaacgtcttcggcggaacacacgcgccgtgatttccttttcgtggccacgggc
gccgtggctgccgtgggagcagccgccgtcgtctggccgctgatctcccagatgaacccg
gacgcttcgaccatcgcggcgggtgcgccgatcgatgtcgacctggcgccgatcgccgaa
ggacaggacatcaaggtgttctggcgcggcaagccgatctacatcatgcaccgtaccaag
aagcagatcgacgaggcgcgcgcggttacgatcgcgagcctgcccgatccgcagaccgac
caggcccgcgtcaaggaaggccatgaccagtggctggtggtgatcggcatctgcacccat
ctcggctgcattccgatcgcccatgaaggcaagtacgacggcttcttctgcccgtgccat
ggttcgcagtatgattcttcgggccgcatccggtccggccccgcgccgctgaatttgccg
gtgccgccttacgccttcgcatccgacagcaagatcaagatcggctga

DBGET integrated database retrieval system