Thermosulfuriphilus ammonigenes: G4V39_07900 Help Entry G4V39_07900       CDS       T06469                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tav  Thermosulfuriphilus ammonigenes Pathway tav01100   Metabolic pathways tav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tav00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G4V39_07900 (acpP)    00074 Mycolic acid biosynthesis     G4V39_07900 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G4V39_07900 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QIJ72196 UniProt:  A0A6G7PXB8 LinkDB All DBs Position 1621835..1622068 Genome browser AA seq 77 aa AA seqDB search MSVEEKVIEIIAEQLGVSKDKVKPEASFIDDLGADSLDLVELVMAMEEAFGLEISDEEAE KLRTVKDVIDYIKTHQG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtccgtggaggaaaaagtaattgaaattattgccgaacagctgggagtctccaaagat aaggttaaacctgaggcctccttcatcgatgatcttggagcggattcccttgatctggtg gagctggttatggccatggaagaagcctttggcctggagatctctgatgaagaggctgag aagctgcgtacggtaaaggacgttattgattacatcaaaacccatcagggctaa

DBGET integrated database retrieval system