Tabrizicola piscis: EI545_11815 Help Entry EI545_11815       CDS       T05742                                  Name (GenBank) chemotaxis protein chel   KO K02395   peptidoglycan hydrolase FlgJ Organism taw  Tabrizicola piscis Pathway taw02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:taw00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     EI545_11815  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:taw02035]     EI545_11815 Bacterial motility proteins [BR:taw02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     EI545_11815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  AZL59466 UniProt:  A0A3S8U731 LinkDB All DBs Position complement(2421817..2422101) Genome browser AA seq 94 aa AA seqDB search MTPSPIPGLPPAAADRRQVILAKAQELEATFLAEMLAHAGLGDLQGGFGGGAGEAQFASF LRQEQARLMVDGGGIGLAEMIFNTLMEADHAHNA NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccccatccccgattcccggcctgcccccggcggcagcagaccgacggcaggtcatt ctggccaaggcccaagaacttgaggccacctttctggcagaaatgctggcgcatgcgggc cttggggatctgcagggcggctttggcggtggcgcgggcgaagcgcagtttgccagcttt ctgcggcaggaacaggcccggctgatggtcgacggcggcggcatcgggcttgccgagatg attttcaacacattgatggaagcagaccatgcccacaacgcttga

DBGET integrated database retrieval system