Tabrizicola piscis: EI545_12410 Help Entry EI545_12410       CDS       T05742                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism taw  Tabrizicola piscis Pathway taw01100   Metabolic pathways taw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:taw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI545_12410    00074 Mycolic acid biosynthesis     EI545_12410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI545_12410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZL59566 UniProt:  A0A3S8U7D3 LinkDB All DBs Position complement(2536658..2536918) Genome browser AA seq 86 aa AA seqDB search MNVRPAVIAALDKTSGLLDRPSLASLALSGGDFDLSELDIDSLATYEIIMQLEDEFGIDL PPASIASTTTLCDLVDVVARAVQAKP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgtccgaccagcagtcattgctgcccttgataagaccagtggtttgctcgatcgc ccgtcgttggcttcacttgccctgtcgggcggggactttgatttgtccgagttggacatc gacagcttggcaacatacgagataatcatgcagcttgaagatgaattcggtatcgacctt ccaccggcgtcaattgcgtccacgacgacgctttgcgaccttgttgatgtggtggcgcgc gcagttcaagccaagccatga

DBGET integrated database retrieval system