Tabrizicola piscis: EI545_14770
Help
Entry
EI545_14770 CDS
T05742
Name
(GenBank) histidine phosphatase family protein
Organism
taw
Tabrizicola piscis
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
His_Phos_1
His_Phos_2
Motif
Other DBs
NCBI-ProteinID:
AZL59984
UniProt:
A0A3S8U8Q6
LinkDB
All DBs
Position
3037093..3037686
Genome browser
AA seq
197 aa
AA seq
DB search
MIYLLRHGQTEFNHAGRYQGRLDSPLTARGEAQAFEMGRVLAERIDPAKAVILTSPLPRA
LRTAGIIGAGLGLEPVIDPRLIEVSLGAWEGLTAEEIDTGWPGVREGFRRNEWFFGAPGG
EDYPSVAGRMASLLAELPRDDGPVHVLVSHAISGRVLRGLHAGLEPHRAMRLEIPQDAFF
SLHAGGDIRRIDCAPPV
NT seq
594 nt
NT seq
+upstream
nt +downstream
nt
atgatctacctgctgcggcacgggcagaccgaattcaaccatgccgggcgctatcagggc
cggttggattcgcccctgaccgcgcgcggggaagcgcaagctttcgaaatgggcagggtg
ctggctgaacggatcgacccggcgaaggccgtcatcctgaccagccctttgccgcgtgcg
ctgcgcacggcaggcatcattggggccggtcttgggttggagccggtgatcgacccacgg
ctgatcgaggtgtcgcttggggcttgggaagggcttacggccgaggagatcgacaccggt
tggcccggcgtgcgtgaggggttccggcgcaacgaatggttcttcggcgcccccggcggt
gaggattatccaagcgttgcaggccgcatggcaagcctgctggccgaactgccgcgcgac
gacggcccggtgcatgtgctggtcagccatgcaatttccggtcgggtcttgcgcggactt
cacgccgggctggagccgcaccgcgccatgcggctggagattccacaagacgcattcttt
tcgctgcacgccgggggggacatccgtcgcatcgactgcgcgccacccgtttga
DBGET
integrated database retrieval system