Tabrizicola piscis: EI545_19455 Help Entry EI545_19455       CDS       T05742                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism taw  Tabrizicola piscis Pathway taw01100   Metabolic pathways taw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:taw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI545_19455    00074 Mycolic acid biosynthesis     EI545_19455   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI545_19455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AZL60806 UniProt:  A0A3S8UB28 LinkDB All DBs Position 4020004..4020237 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgaccgcgtgaagaagatcgtcgtcgagcatctgggcgtcgaagag gacaaggtgaccgaatctgcctcgttcatcgacgatctgggcgcggactcgctggacacc gtcgaactggtcatggccttcgaggaagaattcgggatcgagattcccgatgacgccgcc gaaaccatccagaccttcggcgatgcagtgaaattcatctccgaagccgcctaa

DBGET integrated database retrieval system