Tabrizicola piscis: EI545_20220 Help Entry EI545_20220       CDS       T05742                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism taw  Tabrizicola piscis Pathway taw01100   Metabolic pathways taw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:taw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EI545_20220    00074 Mycolic acid biosynthesis     EI545_20220   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EI545_20220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AZL60943 UniProt:  A0A3S8UBE0 LinkDB All DBs Position 4172962..4173225 Genome browser AA seq 87 aa AA seqDB search MQTDVEMAVIEILAAQLLLTPSEIAPDARVDDLGLDSLGKVEAIFALEERFGITIPFNAN EPDLPDFDFASVPGIVAGVARLIAERG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcaaacggacgttgaaatggcagtgatcgagattctcgcagcgcagctattgctgacc ccgtccgagattgccccggatgcgcgggtggatgatctgggtctggacagtcttggcaag gtcgaggcgatctttgcgctggaggaacgctttggcatcaccatcccattcaacgccaat gaacccgacctgccggacttcgacttcgcctcggtccctggcattgttgcgggcgtggcg cggctgatcgccgaacggggatga

DBGET integrated database retrieval system