Leadbettera azotonutricia: TREAZ_1812 Help Entry TREAZ_1812        CDS       T01506                                  Name (GenBank) conserved domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism taz  Leadbettera azotonutricia Pathway taz00020   Citrate cycle (TCA cycle) taz00720   Other carbon fixation pathways taz01100   Metabolic pathways taz01110   Biosynthesis of secondary metabolites taz01120   Microbial metabolism in diverse environments taz01200   Carbon metabolism taz01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:taz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     TREAZ_1812   09102 Energy metabolism    00720 Other carbon fixation pathways     TREAZ_1812 Enzymes [BR:taz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      TREAZ_1812 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_9 Fer4_16 Fer4_15 Fer4_4 Fer4_3 Fer4_8 Fer4_13 Fer4_22 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  AEF80210 UniProt:  F5YBZ2 LinkDB All DBs Position complement(553718..553948) Genome browser AA seq 76 aa AA seqDB search MARRGKVVIDRELCKGCFLCIRACPVKVLEEDTEPNSTGTYPTKAAHPEKCIACGSCFEV CPDVCIELFELEGAEA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccaggagaggtaaagttgtcatcgaccgggaactgtgcaagggctgctttttatgc atccgcgcctgtccggtcaaggttttggaagaggatacggagccgaactccacgggtact tacccgacaaaggcggcccatcctgaaaagtgcatagcctgcgggagctgtttcgaagta tgccccgatgtctgcatcgagctttttgaacttgagggggcggaagcatga

DBGET integrated database retrieval system