Leadbettera azotonutricia: TREAZ_1831 Help Entry TREAZ_1831        CDS       T01506                                  Name (GenBank) conserved hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism taz  Leadbettera azotonutricia Pathway taz02020   Two-component system taz02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:taz00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     TREAZ_1831  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     TREAZ_1831  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:taz02035]     TREAZ_1831 Bacterial motility proteins [BR:taz02035]  Flagellar system   Flagellar assembly proteins    Others     TREAZ_1831 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  AEF82124 UniProt:  F5YBX5 LinkDB All DBs Position 533676..533960 Genome browser AA seq 94 aa AA seqDB search MTIGRIDSIDPIPPGKKPGQGSQVNEASQTDSISISSEAVEKAEMLRVMEMVNTAPDVRT DRVEELRAKINDPSYINDKVLDATADKIFDALFG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccatcggcaggatagattctattgatcccattccccccggcaaaaagcccggacag gggagccaggtcaatgaggcttcccagaccgactccatcagcatctcttcggaggctgta gagaaggccgagatgctccgcgttatggagatggtgaacaccgcccctgatgtgcgcaca gatcgggttgaggaactcagggccaagatcaatgatccctcttatataaacgacaaggtg ctggacgccactgcggacaagatttttgatgccctcttcggctaa

DBGET integrated database retrieval system