Thermococcus barophilus: TERMP_02016 Help Entry TERMP_02016       CDS       T01377                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tba  Thermococcus barophilus Pathway tba03010   Ribosome Brite KEGG Orthology (KO) [BR:tba00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     TERMP_02016   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     TERMP_02016  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tba03011]     TERMP_02016    04121 Ubiquitin system [BR:tba04121]     TERMP_02016   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tba04147]     TERMP_02016 Ribosome [BR:tba03011]  Ribosomal proteins   Eukaryotes    Small subunit     TERMP_02016   Archaea     TERMP_02016 Ubiquitin system [BR:tba04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    TERMP_02016 Exosome [BR:tba04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    TERMP_02016   Exosomal proteins of colorectal cancer cells    TERMP_02016 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Ribosomal_L37e Zn_ribbon_IS1595 Zn_ribbon_11 Zn_ribbon_Nudix Zn_ribbon_RPB9 Zn_ribbon_NUD MqsA_antitoxin Motif Other DBs NCBI-ProteinID:  ADT84990 UniProt:  F0LLG1 LinkDB All DBs Position 1800039..1800194 Genome browser AA seq 51 aa AA seqDB search MMGQKWKLYEVKDGKVVRKNKYCPRCGPGVFMANHKDRWACGRCGYTEWKK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgatggggcagaaatggaagctctatgaagttaaggatggcaaagttgtaagaaaaaac aagtactgcccaagatgcggtcctggagttttcatggcaaaccacaaggatagatgggca tgtggaagatgtggctatactgagtggaagaagtga

DBGET integrated database retrieval system