Thermus brockianus: A0O31_01749 Help Entry A0O31_01749       CDS       T04600                                  Name (GenBank) cell division inhibitor MinE   KO K03608   cell division topological specificity factor Organism tbc  Thermus brockianus Brite KEGG Orthology (KO) [BR:tbc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tbc03036]     A0O31_01749   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tbc04812]     A0O31_01749 Chromosome and associated proteins [BR:tbc03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     A0O31_01749 Cytoskeleton proteins [BR:tbc04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    A0O31_01749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MinE NPP-6_helical Motif Other DBs NCBI-ProteinID:  APD09845 UniProt:  A0A1J0LWK0 LinkDB All DBs Position 1575852..1576073 Genome browser AA seq 73 aa AA seqDB search MWWRKRSKEKAKERLKLVLAYDRAKLSPGLVESLKRDLLEVLRRYFPAQEEGLQVALEER GEKMVLVADIPLR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtggtggcgtaaaaggagcaaggaaaaggccaaggaaaggcttaagctggtcctggcc tacgaccgggcgaagctttcccccgggcttgtggaaagcctaaagagggacctcttggag gtgctccgccgctacttccccgcccaggaggaggggctccaggtggccctggaggagcgg ggggagaagatggtcttggtggcggatatccccttgcgctga

DBGET integrated database retrieval system