Thiobacillus denitrificans: Tbd_1533 Help Entry Tbd_1533          CDS       T00275                                  Name (GenBank) host factor Hfq protein   KO K03666   host factor-I protein Organism tbd  Thiobacillus denitrificans Pathway tbd02024   Quorum sensing tbd03018   RNA degradation Brite KEGG Orthology (KO) [BR:tbd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Tbd_1533  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Tbd_1533  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tbd03019]     Tbd_1533    03036 Chromosome and associated proteins [BR:tbd03036]     Tbd_1533 Messenger RNA biogenesis [BR:tbd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Tbd_1533 Chromosome and associated proteins [BR:tbd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Tbd_1533 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AAZ97486 UniProt:  Q3SIN9 LinkDB All DBs Position 1618264..1618506 Genome browser AA seq 80 aa AA seqDB search MAKEHNHLQDVFLNTLRKERIPVSVFLVNGIKLMGRIESFDQFVVLLKGQDQAAQMIFKH AISTISPSREVVLPQRDAEA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggccaaagaacacaatcatctgcaagacgtttttctcaacaccctgcgcaaggaacgc atcccggtctcggtgttcctcgtcaacgggatcaagctgatggggcggatcgagtctttc gatcagttcgtcgtgctgctcaagggccaggaccaggccgcacagatgattttcaagcac gccatctcgacgatttcgccgtcgcgcgaagtcgtgctgccgcagcgcgacgccgaagcc tga

DBGET integrated database retrieval system