Thiobacillus denitrificans: Tbd_1548 Help Entry Tbd_1548          CDS       T00275                                  Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism tbd  Thiobacillus denitrificans Pathway tbd01100   Metabolic pathways tbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tbd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tbd_1548    00074 Mycolic acid biosynthesis     Tbd_1548   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tbd_1548 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Bac_DnaA_C Ribosomal_L12_N CH DnaT_2 Motif Other DBs NCBI-ProteinID:  AAZ97501 UniProt:  Q3SEV2 LinkDB All DBs Position complement(1632987..1633220) Genome browser AA seq 77 aa AA seqDB search MDNVQRVIKVVAEQLGVNEADIKSESSFVGDLGADSLDTVELVMALEEEFGCEIPDEDAE KITTVQQAIDYVNSHSN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggataacgtacagcgtgtaattaaagtcgtcgccgagcagttgggcgtgaacgaggcg gacatcaagagcgagtcctccttcgttggcgaccttggcgccgactcgctcgacaccgtc gagctggtgatggcgctggaagaagaattcggttgcgaaattcccgacgaagacgccgag aaaatcaccaccgtccagcaggccatcgactacgtcaacagccactcgaactga

DBGET integrated database retrieval system