Thiobacillus denitrificans: Tbd_2744 Help Entry Tbd_2744          CDS       T00275                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism tbd  Thiobacillus denitrificans Pathway tbd01100   Metabolic pathways tbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tbd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tbd_2744    00074 Mycolic acid biosynthesis     Tbd_2744   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tbd_2744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAZ98697 UniProt:  Q3SER5 LinkDB All DBs Position 2824727..2824996 Genome browser AA seq 89 aa AA seqDB search MSEVNQELQNEVAELIVSALNLDTRPDEIAADAPLYGEGLGLDSIDILEVALVVSKRYGF QLRADNADNVRIFSSLANLTRHIAANRSK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagtcaaccaggaattgcagaacgaggtagccgagctgatcgtctcggccctc aacctcgacacccgtcccgacgaaatcgcagccgacgcgccgctctacggcgagggcctg gggctcgattcgatcgacatcctggaagtggcgctggtcgtttccaaacgctacggcttc cagttgcgcgcggacaacgcggacaacgtccgcatcttcagttcgctcgccaacctgacc cggcacatcgcggcgaatcgcagcaaatga

DBGET integrated database retrieval system