Trematomus bernacchii (emerald rockcod): 117468862 Help Entry 117468862         CDS       T09643                                  Symbol hmgb1b Name (RefSeq) high mobility group protein B1b   KO K10802   high mobility group protein B1 Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben03410   Base excision repair tben04140   Autophagy - animal tben04217   Necroptosis Brite KEGG Orthology (KO) [BR:tben00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     117468862 (hmgb1b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117468862 (hmgb1b)   09143 Cell growth and death    04217 Necroptosis     117468862 (hmgb1b)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tben03036]     117468862 (hmgb1b)    03400 DNA repair and recombination proteins [BR:tben03400]     117468862 (hmgb1b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117468862 (hmgb1b) Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     117468862 (hmgb1b) DNA repair and recombination proteins [BR:tben03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      117468862 (hmgb1b)    MMR (mismatch excision repair)     Other MMR factors      117468862 (hmgb1b) Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117468862 (hmgb1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Ribosomal_60s NOA36 Motif Other DBs NCBI-GeneID:  117468862 NCBI-ProteinID:  XP_033969102 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MVKVLGKPKGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSQKEKGKFE DLAKLDKVRYERDMQNYDPPAGQRKKRFKDPNAPKRPPSAFFLFCGDFRAKIKSEHPGLT IGDTAKKLGEMWNTSSAENKQPYERKGAKLKEKYDKDVLAYRTKGTVEAAAPPPAAAAAA DDDDDDDEDEEEDDDDDDDE NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggttttgggaaagccgaagggcaaaatgtcctcatatgcctactttgtacaa acatgccgagaggagcataagaagaaacatcctgaagcctctgtcaacttctctgagttc tcaaagaaatgctctgagcgatggaagacaatgtcacagaaagagaagggcaagtttgaa gatttagccaaactagacaaggtgcgttatgagagggacatgcagaattacgatccccca gccggccagaggaagaagcgattcaaggaccccaatgcccccaagagaccaccgtctgca ttcttcctgttctgcggtgactttcgcgcaaagataaaaagcgagcaccctggacttact attggggacactgcaaagaagttgggagagatgtggaacacctcctctgcagagaacaaa cagccatacgagaggaagggtgccaagttgaaggagaagtatgacaaggatgtccttgca taccgcacaaagggcacagttgaggcggcagcacctcctcctgcagcagcagcagcagcg gacgacgatgatgacgatgacgaagatgaagaggaagatgatgatgatgacgatgatgag tag

DBGET integrated database retrieval system