Trematomus bernacchii (emerald rockcod): 117469240 Help Entry 117469240         CDS       T09643                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04010   MAPK signaling pathway tben04137   Mitophagy - animal tben04140   Autophagy - animal tben04218   Cellular senescence tben04371   Apelin signaling pathway tben04519   Cadherin signaling tben04625   C-type lectin receptor signaling pathway tben04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117469240 (rras)    04371 Apelin signaling pathway     117469240 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     117469240 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117469240 (rras)    04137 Mitophagy - animal     117469240 (rras)   09143 Cell growth and death    04218 Cellular senescence     117469240 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117469240 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117469240 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117469240 (rras)    04031 GTP-binding proteins [BR:tben04031]     117469240 (rras) Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117469240 (rras)   Exosomal proteins of bladder cancer cells    117469240 (rras) GTP-binding proteins [BR:tben04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117469240 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 Motif Other DBs NCBI-GeneID:  117469240 NCBI-ProteinID:  XP_033969514 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVGGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDFPMVLVGN KADLEHQRVISREDAQAFTRENRIHYMEASAKNRHNVDECFLELVQIIRKFQEMESPPPQ AHHTGKKKSGDCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcagaagaagaacgattcaaactggttgtggtgggtgggggcggggtggggaag agcgccctcaccatccagttcatccagtcctactttgtgtcagactacgaccccaccatc gaggactcctacaccaagatctgcaccgttggggggaaggagacccggctggacatcctg gatacagcaggtcaggaggagtttggagcgatgagggagcagtacatgcgctcaggagaa ggctttctattggtgtttgcactcaacgaccggggcagctaccacgaggtgcagaagttc cacacgcagatcctgagagtgaaggaccgggatgacttccccatggtgctggttggaaac aaggcggacctggagcatcagagagtgatctccagggaggatgcccaggcgttcaccaga gagaacaggatccactacatggaggcttctgccaagaatcgccacaacgtggatgaatgc ttcttggagctggtacaaattatcagaaagtttcaggagatggagagtcctcccccccaa gctcatcacacagggaaaaagaagagcggggactgtccctgtgtcctgctctga

DBGET integrated database retrieval system