Trematomus bernacchii (emerald rockcod): 117470640 Help Entry 117470640         CDS       T09643                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04020   Calcium signaling pathway tben04070   Phosphatidylinositol signaling system tben04114   Oocyte meiosis tben04218   Cellular senescence tben04261   Adrenergic signaling in cardiomyocytes tben04270   Vascular smooth muscle contraction tben04371   Apelin signaling pathway tben04625   C-type lectin receptor signaling pathway tben04744   Phototransduction tben04910   Insulin signaling pathway tben04912   GnRH signaling pathway tben04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     117470640    04020 Calcium signaling pathway     117470640    04070 Phosphatidylinositol signaling system     117470640  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     117470640    04218 Cellular senescence     117470640  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117470640   09152 Endocrine system    04910 Insulin signaling pathway     117470640    04912 GnRH signaling pathway     117470640    04916 Melanogenesis     117470640   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     117470640    04270 Vascular smooth muscle contraction     117470640   09157 Sensory system    04744 Phototransduction     117470640  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tben01009]     117470640   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tben04131]     117470640    03036 Chromosome and associated proteins [BR:tben03036]     117470640   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117470640 Protein phosphatases and associated proteins [BR:tben01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117470640 Membrane trafficking [BR:tben04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117470640 Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117470640 Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117470640 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 CFAP251_C EF-hand_8 Motif Other DBs NCBI-GeneID:  117470640 NCBI-ProteinID:  XP_033971345 LinkDB All DBs Position Unknown AA seq 179 aa AA seqDB search MVRGLQIFYLRSPSFCFFSHDVSLFSSQAKFLTQEQINDYKECFSLYDRQRRGRIEGGDL ITVMRCLGSSPTPAEVRRHLLTHSDAAGDLDFSSLLSVMHRQQQQEAPQREILEALRRSE GGRRGFMEVSLLRGRLTGQGERLTHKEVDELLQEAGLGSDGQLHCEQFAEAVTRNAAKR NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atggtgagaggattacagattttctacctacgttctccttcgttctgttttttctctcac gatgtttctctgttttcatcgcaggccaagttcctgactcaggagcagattaacgactat aaggagtgtttctctctgtacgaccgtcagcggcggggcaggattgaggggggggatctg atcacagtgatgcgatgcctcgggtcgagccccacccccgctgaggttaggagacacctg ctgacccactcagacgcagctggagatctggacttctcgtccctcctcagcgtgatgcac cgtcagcagcagcaggaggcgccgcagagagagatcctggaggctctgaggaggagtgag ggggggaggaggggcttcatggaggtctccctgctgagggggagactcacagggcagggg gagagactcacacacaaagaggtggacgagctgctgcaggaggcgggacttggatctgac ggacagctccactgcgagcagttcgctgaagccgtgacgcgcaacgctgcaaaacgctga

DBGET integrated database retrieval system