Trematomus bernacchii (emerald rockcod): 117472266 Help Entry 117472266         CDS       T09643                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben03030   DNA replication tben03082   ATP-dependent chromatin remodeling tben03410   Base excision repair tben03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:tben00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     117472266 (pole3)    03410 Base excision repair     117472266 (pole3)    03420 Nucleotide excision repair     117472266 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117472266 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tben03032]     117472266 (pole3)    03036 Chromosome and associated proteins [BR:tben03036]     117472266 (pole3)    03400 DNA repair and recombination proteins [BR:tben03400]     117472266 (pole3) Enzymes [BR:tben01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      117472266 (pole3) DNA replication proteins [BR:tben03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     117472266 (pole3) Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     117472266 (pole3) DNA repair and recombination proteins [BR:tben03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       117472266 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP SpoU_methylase DUF4746 DUF3276 RNA_pol_3_Rpc31 PFF1_TM Motif Other DBs NCBI-GeneID:  117472266 NCBI-ProteinID:  XP_033973331 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLSAMEEMEFERFLEPLREALEVYKKGQKGKKEVSEQKRKDREKKTDSENDK SREEEEEEERMDEEPEAENEAEEEDVEN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcggagagacccgaagatctaaacctgcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggggttaatgtgtcgaaagaagcccggagagccatatcccaagct gccagtgtgtttgtgctgtatgcaacgtcctgtgcaaacaactttgccatgaaagccaaa aggaaaactctgaacgcaggagatgttttgtctgcgatggaggaaatggagtttgaacga ttcctggagcctctcagagaagctctagaagtgtacaagaagggccagaaaggaaagaag gaggtgtctgagcagaaacgtaaagacagagagaagaagaccgactctgagaatgataag agcagggaggaggaagaggaggaagagcgcatggacgaggaacctgaagccgagaatgag gcagaggaggaagatgtggagaattga

DBGET integrated database retrieval system