Trematomus bernacchii (emerald rockcod): 117472873 Help Entry 117472873         CDS       T09643                                  Symbol ccl27a Name (RefSeq) C-C motif chemokine 27a   KO K05513   C-C motif chemokine 28 Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04060   Cytokine-cytokine receptor interaction tben04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117472873 (ccl27a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     117472873 (ccl27a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tben04052]     117472873 (ccl27a) Cytokines and neuropeptides [BR:tben04052]  Cytokines   Chemokines    117472873 (ccl27a) BRITE hierarchy Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  117472873 NCBI-ProteinID:  XP_033974198 EnsemblRapid:  ENSTBNG00005024201 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MDLKVVFAIVCLCALAISSTEAGIPKCCFSVKTDIPLRVLVRVQRWSVQQSSGACDIPAL ILHIKDFRKPICAHPKLKRALMALQARVKRSRQTAREI NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggatctgaaagttgtgtttgcgattgtctgtctgtgcgctctagccatcagctccact gaagctggcattccaaaatgttgcttctcagtaaagacggacattcccctccgagtgctg gtgagggttcagagatggagtgtgcaacagagcagcggtgcctgtgacatccctgcactg attctgcatataaaggatttcaggaagcccatatgtgctcatcccaaactgaagagagcc ctgatggcgctgcaggccagggtgaagcggagcagacagacagcacgagaaatctaa

DBGET integrated database retrieval system