Trematomus bernacchii (emerald rockcod): 117473615 Help Entry 117473615         CDS       T09643                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:tben00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117473615  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:tben04121]     117473615    03400 DNA repair and recombination proteins [BR:tben03400]     117473615 Ubiquitin system [BR:tben04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117473615    Cul5 complex      117473615 DNA repair and recombination proteins [BR:tben03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117473615 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  117473615 NCBI-ProteinID:  XP_033975178 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttttaatgatccggcgtcaaaagaccacaatcttcaccgatgccaaggag tccaccactgtgtatgagctgaagcgtattgttgaaggaattcttaagagaccaccagag gaccagaggctgtataaagatgatcagtcgctagaggacagtaaaactcttggtgactgt ggattcaccaaccagactgccagacctcaagccccagctacagttggtctggccttccgc ataaatgatgagatgttcgagcagctgcacgtcgaggccttctccagccccccagaactc cctgatgtgatgaagccccaggattccggtagcacggccaacgaacaggcggtgcagtga

DBGET integrated database retrieval system