Trematomus bernacchii (emerald rockcod): 117474540 Help Entry 117474540         CDS       T09643                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04060   Cytokine-cytokine receptor interaction tben04218   Cellular senescence tben04620   Toll-like receptor signaling pathway tben04621   NOD-like receptor signaling pathway tben04622   RIG-I-like receptor signaling pathway tben05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117474540  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     117474540  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117474540    04621 NOD-like receptor signaling pathway     117474540    04622 RIG-I-like receptor signaling pathway     117474540  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117474540  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tben04052]     117474540    00536 Glycosaminoglycan binding proteins [BR:tben00536]     117474540 Cytokines and neuropeptides [BR:tben04052]  Cytokines   Chemokines    117474540 Glycosaminoglycan binding proteins [BR:tben00536]  Heparan sulfate / Heparin   Chemokines    117474540 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  117474540 NCBI-ProteinID:  XP_033976267 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MYIITIVALPFFGIISEGISLGDWGGIKHCRCVSKEKKPIGRYIGRVEVNPAGPHCKDIE IIATLKTDGQQICLDPNAPWVKRVLKRKSTGQRP NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtatattataactatcgtggcactgcctttttttggtataatctctgagggtatcagt ctgggggattggggagggattaagcattgtcgatgcgtcagcaaagagaaaaagccaatt ggacgttacataggaagggtggaggtgaatcctgcaggcccccactgcaaagatatagag attattgccactcttaaaacggatgggcagcagatttgtctggaccccaatgctccttgg gtcaaaagagtgctcaagaggaaatcgacagggcagagaccttga

DBGET integrated database retrieval system