Trematomus bernacchii (emerald rockcod): 117489517 Help Entry 117489517         CDS       T09643                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:tben00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     117489517 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tben03036]     117489517 (cenps)    03400 DNA repair and recombination proteins [BR:tben03400]     117489517 (cenps) Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      117489517 (cenps) DNA repair and recombination proteins [BR:tben03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      117489517 (cenps) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone CBFD_NFYB_HMF Serine_rich TFIID-31kDa Motif Other DBs NCBI-GeneID:  117489517 NCBI-ProteinID:  XP_033994732 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MSDDKDETQQRLKAAIHFTVGRLCQKTGEDHRRGFSRQAVAAIAETAFRQCDVFAKDLEA FARHAKRNTVTSEDVKLIARRSTALSIHIQNKTEELNQEKKSTGKRKSRDTEEESKE NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgataaagatgagactcagcagaggttaaaggcagcaatccatttcaccgtt ggtcgcctgtgccagaagacgggagaggaccaccggagagggttcagccgacaagctgta gcagcgatagccgagacagcgttcagacaatgcgatgtatttgctaaagacttggaggcc tttgcaagacatgctaaaagaaacacagtgacttcagaagatgtgaagctcatagcccgt cgcagtacagcattgtccatccacatacaaaataaaactgaagaactgaaccaggaaaag aagagtactgggaagaggaaaagcagagacactgaggaggagagcaaagaataa

DBGET integrated database retrieval system