Trematomus bernacchii (emerald rockcod): 117490428 Help Entry 117490428         CDS       T09643                                  Symbol hmgb1a Name (RefSeq) high mobility group protein B1a   KO K10802   high mobility group protein B1 Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben03410   Base excision repair tben04140   Autophagy - animal tben04217   Necroptosis Brite KEGG Orthology (KO) [BR:tben00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     117490428 (hmgb1a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117490428 (hmgb1a)   09143 Cell growth and death    04217 Necroptosis     117490428 (hmgb1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tben03036]     117490428 (hmgb1a)    03400 DNA repair and recombination proteins [BR:tben03400]     117490428 (hmgb1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117490428 (hmgb1a) Chromosome and associated proteins [BR:tben03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     117490428 (hmgb1a) DNA repair and recombination proteins [BR:tben03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      117490428 (hmgb1a)    MMR (mismatch excision repair)     Other MMR factors      117490428 (hmgb1a) Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117490428 (hmgb1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 Motif Other DBs NCBI-GeneID:  117490428 NCBI-ProteinID:  XP_033996066 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MVREPGKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKPLTAKEKGKFE DLARQDKVRYEREMMNYVPASGGKKKRFKDPNAPKRPPSAFFVFCAEYRPKVKEESPGLT IGDTAKRLGEMWNGTASEDKQPFEKKAAKLKEKYEKDVAAYRAKGKTGTSAPAPAAKAPA KVEKKEDDDDDDDDEEDDDFDDDDDE NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggtgagagagccaggaaagcccaggggcaagatgtcctcctatgcctattttgtccag acctgtcgggaggagcacaagaagaaacaccctgaagcttcggttaacttctccgagttc tccaagaagtgctctgagcgatggaagccattgactgctaaggagaaaggaaaatttgag gacctggccaggcaggacaaggtgcgctatgagagagagatgatgaactacgttccagcc agtggaggcaagaagaagaggttcaaggaccccaatgcacccaaaaggcccccatctgcc ttcttcgtcttttgcgcggagtatcgccctaaggtgaaagaagagtcccctggtttgacc attggagatactgccaagaggcttggggagatgtggaatggcaccgcttcagaggacaag cagccctttgagaagaaagcggctaaactgaaggagaagtatgagaaggacgtagcagca taccgcgctaagggcaaaacaggaaccagtgcccccgcacctgcagcaaaagccccggcc aaggtagagaagaaggaggatgacgatgatgatgatgatgacgaggaggatgacgacttt gatgatgatgatgacgagtag

DBGET integrated database retrieval system