Trematomus bernacchii (emerald rockcod): 117490759 Help Entry 117490759         CDS       T09643                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04145   Phagocytosis tben04517   IgSF CAM signaling tben04814   Motor proteins tben05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117490759 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     117490759 (dynll2b)   09142 Cell motility    04814 Motor proteins     117490759 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117490759 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tben03037]     117490759 (dynll2b)    04812 Cytoskeleton proteins [BR:tben04812]     117490759 (dynll2b) Cilium and associated proteins [BR:tben03037]  Motile cilia and associated proteins   Dynein arm    117490759 (dynll2b) Cytoskeleton proteins [BR:tben04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117490759 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Motif Other DBs NCBI-GeneID:  117490759 NCBI-ProteinID:  XP_033996463 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MSDKKAVIKNADMPDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaaaggcagtgataaagaatgcggacatgcctgatgaaatgcagcaggat gcagtggactgtgccatgcaggctatggaaaagtacaacattgagaaggatattgctgct tatgtcaaaaaggagtttgacaagaagtacaaccccacatggcattgcattgttgggagg aactttggcagctacgtgacgcacgagaccaagcatttcatttacttctacctgggccaa gtggctatactactgttcaagtcaggctga

DBGET integrated database retrieval system