Trematomus bernacchii (emerald rockcod): 117490759 Help Entry 117490759         CDS       T09643                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04814   Motor proteins tben05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tben00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117490759 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117490759 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:tben03037]     117490759 (dynll2b)    04812 Cytoskeleton proteins [BR:tben04812]     117490759 (dynll2b) Cilium and associated proteins [BR:tben03037]  Motile cilia and associated proteins   Dynein arm    117490759 (dynll2b) Cytoskeleton proteins [BR:tben04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117490759 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Motif Other DBs NCBI-GeneID:  117490759 NCBI-ProteinID:  XP_033996463 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MSDKKAVIKNADMPDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaaaaaggcagtgataaagaatgcggacatgcctgatgaaatgcagcaggat gcagtggactgtgccatgcaggctatggaaaagtacaacattgagaaggatattgctgct tatgtcaaaaaggagtttgacaagaagtacaaccccacatggcattgcattgttgggagg aactttggcagctacgtgacgcacgagaccaagcatttcatttacttctacctgggccaa gtggctatactactgttcaagtcaggctga

DBGET integrated database retrieval system