Trematomus bernacchii (emerald rockcod): 117491329 Help Entry 117491329         CDS       T09643                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism tben  Trematomus bernacchii (emerald rockcod) Brite KEGG Orthology (KO) [BR:tben00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tben03019]     117491329 (mt2)    03029 Mitochondrial biogenesis [BR:tben03029]     117491329 (mt2) Messenger RNA biogenesis [BR:tben03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      117491329 (mt2) Mitochondrial biogenesis [BR:tben03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     117491329 (mt2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  117491329 NCBI-ProteinID:  XP_033997131 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGGSCTCTNCSCTSCKKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccctgcgactgctccaaaagtgggacctgcaactgcggaggatcctgcacttgc acaaactgctcctgcaccagctgcaagaagagctgctgcccatgctgcccatccggctgc accaaatgcgcctctggctgtgtgtgcaaagggaagacttgtgacacaagttgctgtcag tga

DBGET integrated database retrieval system