Trematomus bernacchii (emerald rockcod): 117491619 Help Entry 117491619         CDS       T09643                                  Symbol hrasb Name (RefSeq) HRas proto-oncogene, GTPase b   KO K02833   GTPase HRas Organism tben  Trematomus bernacchii (emerald rockcod) Pathway tben04010   MAPK signaling pathway tben04012   ErbB signaling pathway tben04068   FoxO signaling pathway tben04137   Mitophagy - animal tben04140   Autophagy - animal tben04144   Endocytosis tben04150   mTOR signaling pathway tben04210   Apoptosis tben04218   Cellular senescence tben04370   VEGF signaling pathway tben04371   Apelin signaling pathway tben04510   Focal adhesion tben04540   Gap junction tben04625   C-type lectin receptor signaling pathway tben04810   Regulation of actin cytoskeleton tben04910   Insulin signaling pathway tben04912   GnRH signaling pathway tben04916   Melanogenesis tben05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tben00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117491619 (hrasb)    04012 ErbB signaling pathway     117491619 (hrasb)    04370 VEGF signaling pathway     117491619 (hrasb)    04371 Apelin signaling pathway     117491619 (hrasb)    04068 FoxO signaling pathway     117491619 (hrasb)    04150 mTOR signaling pathway     117491619 (hrasb)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117491619 (hrasb)    04140 Autophagy - animal     117491619 (hrasb)    04137 Mitophagy - animal     117491619 (hrasb)   09143 Cell growth and death    04210 Apoptosis     117491619 (hrasb)    04218 Cellular senescence     117491619 (hrasb)   09144 Cellular community - eukaryotes    04510 Focal adhesion     117491619 (hrasb)    04540 Gap junction     117491619 (hrasb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117491619 (hrasb)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117491619 (hrasb)   09152 Endocrine system    04910 Insulin signaling pathway     117491619 (hrasb)    04912 GnRH signaling pathway     117491619 (hrasb)    04916 Melanogenesis     117491619 (hrasb)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117491619 (hrasb)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tben04131]     117491619 (hrasb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tben04147]     117491619 (hrasb)    04031 GTP-binding proteins [BR:tben04031]     117491619 (hrasb) Membrane trafficking [BR:tben04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117491619 (hrasb)  Endocytosis   Macropinocytosis    Ras GTPases     117491619 (hrasb) Exosome [BR:tben04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117491619 (hrasb)   Exosomal proteins of colorectal cancer cells    117491619 (hrasb) GTP-binding proteins [BR:tben04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117491619 (hrasb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  117491619 NCBI-ProteinID:  XP_033997582 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcacttacc atccaactcatccagaaccactttgtggatgaatatgatcccaccatagaggactcgtac aggaaacaggttgtgattgacggagagacctgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggatcaatacatgaggacaggggagggctttctctgc gtcttcgccatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatc aaacgtgtaaaggactcggacgatgttcccatggtgcttgtgggaaacaaatgtgacctc ccgacacgcacggtagacacgaggcaagcccaggaactcgcccgctcttacggcatccca tacatcgagacctctgctaaaacacgacagggagtagaggacgccttctacacgctggtt agggagatcagacagcataagctgaggaagctgaacccccccgatgagagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system